PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G319700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family NAC
Protein Properties Length: 349aa    MW: 37756.5 Da    PI: 6.621
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G319700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.52.1e-5261331128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lppGfrFhPtd+elv +yLk+kv++ k+el evi+ +d+yk+ePw+Lp k  + +++ ew+fF++rd+ky++g+r+nrat++gyWkatgkd
  Sevir.9G319700.1.p   6 LPPGFRFHPTDDELVGYYLKRKVDNLKIEL-EVIPVIDLYKSEPWELPeKsFLPKRDLEWFFFCPRDRKYPNGSRTNRATATGYWKATGKD 95 
                         79****************************.99**************95334445667********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +++ + +g + gl+ktLvfy+grap ge+tdWvmheyrl
  Sevir.9G319700.1.p  96 RRIAC-DGGVYGLRKTLVFYRGRAPGGERTDWVMHEYRL 133
                         *****.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-603155IPR003441NAC domain
PROSITE profilePS5100557.016156IPR003441NAC domain
PfamPF023655.1E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MGTMTLPPGF RFHPTDDELV GYYLKRKVDN LKIELEVIPV IDLYKSEPWE LPEKSFLPKR  60
DLEWFFFCPR DRKYPNGSRT NRATATGYWK ATGKDRRIAC DGGVYGLRKT LVFYRGRAPG  120
GERTDWVMHE YRLCQDLAHG ACNFIGAYAL CRVIKRHEAG LLQGEPTAAK AKGASNAAGA  180
ARGQMSKVSS SSSLFSSEQL SAFTPTNSSP PPPTLDISNT FQSPLVYGGD ATATATTGLP  240
SSPLPPPLFV PSSHPSPHDA FFIGDDFPAA VASESRSLFT GGGGDMGMGV AEHDLRWDSL  300
ITCPSTFSNG AEVWNTAASP MLCRQASDGG GADDLAAFFF SDETRIVF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-51115912168NO APICAL MERISTEM PROTEIN
1ut4_B1e-51115912168NO APICAL MERISTEM PROTEIN
1ut7_A1e-51115912168NO APICAL MERISTEM PROTEIN
1ut7_B1e-51115912168NO APICAL MERISTEM PROTEIN
3swm_A2e-51116015172NAC domain-containing protein 19
3swm_B2e-51116015172NAC domain-containing protein 19
3swm_C2e-51116015172NAC domain-containing protein 19
3swm_D2e-51116015172NAC domain-containing protein 19
3swp_A2e-51116015172NAC domain-containing protein 19
3swp_B2e-51116015172NAC domain-containing protein 19
3swp_C2e-51116015172NAC domain-containing protein 19
3swp_D2e-51116015172NAC domain-containing protein 19
4dul_A1e-51115912168NAC domain-containing protein 19
4dul_B1e-51115912168NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002467457.11e-158hypothetical protein SORBIDRAFT_01g028450
TrEMBLC5WRD21e-158C5WRD2_SORBI; Putative uncharacterized protein Sb01g028450
STRINGSb01g028450.11e-157(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62093854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.12e-82NAC domain containing protein 71